PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03584.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 376aa    MW: 43196.9 Da    PI: 7.0131
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03584.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B355.11.3e-177703398
                             -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                       B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                             s++++ +d++ r+W++k+ +r++++r+++++GW+eF+k++ L +gD++vF   + +++e +v++++
  Rsa1.0_03584.1_g00001.1  7 SQEIVAKDLHDRVWKFKHMFRGTPRRHIFASGWSEFAKQKSLAVGDSFVFL--RGENGESRVGIRK 70
                             569************************************************..3478888999987 PP

2Auxin_resp87.32.9e-2997174383
               Auxin_resp   3 haastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                               a++tk++Fev+Y+P++  s+F+v+++k+ +a+++k+ +G+Rf m+fe+ d++e+++sGt+v v+d  +++W++S+WrsL+
  Rsa1.0_03584.1_g00001.1  97 IAIKTKCTFEVFYKPKS--SQFIVNCDKFIDAMNKKFNIGSRFTMKFEGHDFNEIEYSGTIVKVED-FSINWKDSEWRSLQ 174
                              689************95..9**********************************************.667*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.619172IPR003340B3 DNA binding domain
SMARTSM010192.1E-4172IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.2E-20379IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-17370IPR015300DNA-binding pseudobarrel domain
PfamPF023626.5E-15771IPR003340B3 DNA binding domain
CDDcd100174.31E-14770No hitNo description
PfamPF065075.3E-2795174IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MSQLTPSQEI VAKDLHDRVW KFKHMFRGTP RRHIFASGWS EFAKQKSLAV GDSFVFLRGE  60
NGESRVGIRK AAPHQSNISP VISKESMHHG LIATASIAIK TKCTFEVFYK PKSSQFIVNC  120
DKFIDAMNKK FNIGSRFTMK FEGHDFNEIE YSGTIVKVED FSINWKDSEW RSLQVQWDEA  180
ATITRPNKIS PWDIQPKSEI NELVSYAGPV MSRPNYNDPM VQSAKTNLNT NASCSFRLFG  240
IDLTTSTKER NVLEPVDPYQ RTKSTEIFEE EKLDQIQTGT SLTEFQRKEI SFTTCSTKID  300
TTIFSSQTLD MFIDQVHMES VVRTVDLNAF EGYNHMIVEL QKLFNIKGKF QNQWKLTFKD  360
NEGDTVLSGE DPYPWP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B5e-691196155354Auxin response factor 1
4ldw_A5e-691196155354Auxin response factor 1
4ldv_A5e-691196155354Auxin response factor 1
4ldx_B6e-691196155354Auxin response factor 1
4ldx_A6e-691196155354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794880.0JN979488.1 Brassica rapa subsp. pekinensis auxin response factor 27 (ARF27) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013654600.10.0PREDICTED: putative auxin response factor 21
RefseqXP_013710711.10.0PREDICTED: putative auxin response factor 21
SwissprotQ9C8N91e-107ARFU_ARATH; Putative auxin response factor 21
TrEMBLA0A078GBD40.0A0A078GBD4_BRANA; Auxin response factor
STRINGBra034234.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7653631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34410.11e-108auxin response factor 21